PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT29022
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family NF-YA
Protein Properties Length: 284aa    MW: 31154 Da    PI: 8.7561
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT29022genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA100.12.2e-31119175158
  CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                d+p+YVNaKQy++Il+RR +Rak+e+e++l  k+rkpylheSRh hA+rR+RgsgGrF
   EMT29022 119 DAPIYVNAKQYEGILRRRRARAKAEKENRL-VKARKPYLHESRHLHAMRRARGSGGRF 175
                68****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005212.8E-35117178IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115237.01118178IPR001289Nuclear transcription factor Y subunit A
PfamPF020452.8E-28121175IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006162.0E-23121143IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860123143IPR018362CCAAT-binding factor, conserved site
PRINTSPR006162.0E-23152175IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009567Biological Processdouble fertilization forming a zygote and endosperm
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 284 aa     Download sequence    Send to blast
MSMSPPEDAC RDGQFQVVPR AQALLDAVPL PQPPMGERGI PEALKFSMAH GKGGNSSEHS  60
APITLQSPFT EYNDHFELGL GQSVISSNYY SDQQYGLLSY GMRSASSGRM LIPLNMPADA  120
PIYVNAKQYE GILRRRRARA KAEKENRLVK ARKPYLHESR HLHAMRRARG SGGRFLNTKK  180
ETNGKDTGVG SKAMVGNPLM RSAASLSSEI QHSEQGNPSS VSSLSGSEVT SLYDHEDVDH  240
YHNFEHLRTH FFTPLPSIMD GEHGAGNPFK WAAASDGCCN LLKA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A6e-18119183266NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM0787580.0KM078758.1 Triticum aestivum CCAAT-binding transcription factor B (NFYA-D6) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003577268.11e-150PREDICTED: nuclear transcription factor Y subunit A-2-like isoform X1
RefseqXP_010237001.11e-150PREDICTED: nuclear transcription factor Y subunit A-2-like isoform X1
RefseqXP_014757443.11e-150PREDICTED: nuclear transcription factor Y subunit A-2-like isoform X1
TrEMBLM8CNG20.0M8CNG2_AEGTA; Nuclear transcription factor Y subunit A-2
STRINGMLOC_76757.21e-175(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23073790
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G05690.15e-28nuclear factor Y, subunit A2